Connexin 45/GJA7 Polyclonal Antibody

Code	A08562
Brand	Boster
Title	Connexin 45/GJA7 Polyclonal Antibody
Description	Connexin 45/GJA7 Polyclonal Antibody
Size	100 ug
alternative_name	Gap junction gamma-1 protein \| Connexin-45 \| Cx45 \| Gap junction alpha-7 protein \| GJC1 \| GJA7 \| P36383
clone	N/A
concentration	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Scheda prodotto	LINK
format	N/A
general_information	Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.
host	Rabbit
immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91-131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE), identical to the related mouse and rat sequences.
isotype	N/A
protein_id	GJC1
purity	Immunogen affinity purified.
storage	At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Application	WB,IHC-P
Target species	Hu, Ms, Rt
Host	Rabbit
Class	Polyclonal
Labeled	Unconjugated