| Code | A13093-1 |
| Brand | Boster |
| Title | FDCSP Polyclonal Antibody |
| Description | FDCSP Polyclonal Antibody |
| Size | 100 ug |
| alternative_name | C4orf7 | FDC-SP | FDCSP | Q8NFU4 |
| clone | N/A |
| concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Scheda prodotto | LINK |
| format | N/A |
| general_information | FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion. |
| host | Rabbit |
| immunogen | A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR). |
| isotype | N/A |
| protein_id | FDCSP |
| purity | Immunogen affinity purified. |
| storage | At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing. |
| Application | IHC-P |
| Target species | Hu |
| Host | Rabbit |
| Class | Polyclonal |
| Labeled | Unconjugated |
Attendere..
