| Code | PB9846 |
| Brand | Boster |
| Title | BCAR3 Polyclonal Antibody |
| Description | BCAR3 Polyclonal Antibody |
| Size | 100 ug |
| alternative_name | BCAR 3 antibody|BCAR3 antibody|BCAR3_HUMAN antibody|Breast cancer anti estrogen resistance 3 antibody|Breast cancer anti estrogen resistance protein 3 antibody|Breast cancer anti-estrogen resistance protein 3 antibody|Breast cancer antiestrogen resistance 3 antibody|dJ1033H22.2 antibody|dJ1033H22.2 breast cancer anti estrogen resistance 3 antibody|dJ1033H22.2 breast cancer antiestrogen resistance 3 antibody|KIAA0554 antibody|Novel SH2 containing protein 2 antibody|Novel SH2-containing protein 2 antibody|NSP 2 antibody|NSP2 antibody|SH2 containing protein Nsp2 antibody|SH2 domain containing protein 3B antibody|SH2 domain-containing protein 3B antibody|SH2D3B antibody |
| clone | N/A |
| concentration | N/A |
| Scheda prodotto | LINK |
| format | Whole IgG |
| general_information | Breast cancer anti-estrogen resistance protein 3 is a protein that in humans is encoded by the BCAR3 gene. Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. Multiple transcript variants encoding different isoforms have been found for this gene. |
| host | Rabbit |
| immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL), different from the related mouse sequence by five amino acids. |
| isotype | IgG |
| Secondary antibodies | LINK |
| protein_id | O75815 |
| purity | Affinity purified |
| storage | At -20Ú C for one year. After reconstitution, at 4Ú C for one month. It can also be aliquotted and stored frozen at -20Ú C for a longer time. Avoid repeated freezing and thawing. |
| Application | WB,IHC-P |
| Target species | Hu, Ms, Rt |
| Host | Rabbit |
| Class | Polyclonal |
| Labeled | Unconjugated |
Attendere..
