Flat Preloader Icon Attendere..
CodeA07691
BrandBoster
TitleHnRNP H Polyclonal Antibody
DescriptionHnRNP H Polyclonal Antibody
Size100 ug
alternative_namehnRNP H | hnRNPH | Hnrnph1 | HNRPH 1 | HNRPH | HNRPH1 protein | P31943
cloneN/A
concentrationN/A
Scheda prodottoLINK
formatWhole IgG
general_informationHeterogeneous nuclear ribonucleoprotein H is a protein that in humans is encoded by the HNRNPH1 gene. This gene encodes a member of a subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA. These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some may shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNA and is very similar to the family member HNRPF. This gene may be associated with hereditary lymphedema type I. Alternatively spliced transcript variants have been described.
hostRabbit
immunogenA synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP H (23-52aa SADEVQRFFSDCKIQNGAQGIRFIYTREGR), identical to the related mouse and rat sequences.
isotypeIgG
Secondary antibodiesLINK
protein_idP31943
purityImmunogen affinity purified.
storageAt -20Ú C for one year. After reconstitution, at 4Ú C for one month. It can also be aliquotted and stored frozen at -20Ú C for a longer time. Avoid repeated freezing and thawing.
ApplicationWB
Target speciesHu
HostRabbit
ClassPolyclonal
LabeledUnconjugated