| Code | A08379-1 |
| Brand | Boster |
| Title | ADAM2 Polyclonal Antibody |
| Description | ADAM2 Polyclonal Antibody |
| Size | 100 ug |
| alternative_name | ADAM2 | CT15 | Fertilin beta | Fertilin subunit beta | Ftnb | PH30 | PH-30 | Ph30 beta | PH30-beta | Q99965 |
| clone | N/A |
| concentration | N/A |
| Scheda prodotto | LINK |
| format | Whole IgG |
| general_information | ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2. |
| host | Rabbit |
| immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids. |
| isotype | IgG |
| Secondary antibodies | LINK |
| protein_id | Q99965 |
| purity | Immunogen affinity purified. |
| storage | At -20Ú C for one year. After reconstitution, at 4Ú C for one month. It can also be aliquotted and stored frozen at -20Ú C for a longer time. Avoid repeated freezing and thawing. |
| Application | WB |
| Target species | Hu, Ms, Rt |
| Host | Rabbit |
| Class | Polyclonal |
| Labeled | Unconjugated |
Attendere..
