SP6 Picoband™ Polyclonal Antibody

Code	A08730-1
Brand	Boster
Title	SP6 Picoband™ Polyclonal Antibody
Description	SP6 Picoband™ Polyclonal Antibody
Size	100 µg
alternative_name	Transcription factor Sp6
clone	N/A
concentration	N/A
Scheda prodotto	LINK
format	Whole IgG
general_information	SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes. By somatic cell hybrid analysis and FISH, he SP6 gene is mapped t to chromosome 17q21.3-q22.
host	Rabbit
immunogen	A synthetic peptide corresponding to a sequence of human SP6 (QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH).
isotype	IgG
Secondary antibodies	LINK
protein_id	Q3SY56
storage	At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Application	WB
Target species	Hu, Ms, Rt
Host	Rabbit
Class	Polyclonal
Labeled	Unconjugated