| Code | A09279 |
| Brand | Boster |
| Title | AKAP2 Polyclonal Antibody |
| Description | AKAP2 Polyclonal Antibody |
| Size | 100 ug |
| alternative_name | AKAP 2 | AKAP KL | AKAPKL | KIAA0920 | PRKA 2 | PRKA2 | MISP2 | Q9Y2D5 |
| clone | N/A |
| concentration | N/A |
| Scheda prodotto | LINK |
| format | Whole IgG |
| general_information | A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene. |
| host | Rabbit |
| immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AKAP2 (813-852aa ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN), identical to the related mouse and rat sequences. |
| isotype | IgG |
| Secondary antibodies | LINK |
| protein_id | Q9Y2D5 |
| purity | Immunogen affinity purified. |
| storage | At -20Ú C for one year. After reconstitution, at 4Ú C for one month. It can also be aliquotted and stored frozen at -20Ú C for a longer time. Avoid repeated freezing and thawing. |
| Application | WB |
| Target species | Hu, Rt |
| Host | Rabbit |
| Class | Polyclonal |
| Labeled | Unconjugated |
Attendere..
