| Code | A05747-1 |
| Brand | Boster |
| Title | ANGPTL2 Polyclonal Antibody |
| Description | ANGPTL2 Polyclonal Antibody |
| Size | 100 ug |
| alternative_name | AI593246 | Angptl2 | Arp2 | HARP | MGC8889 | UNQ170/PRO196 | Q9UKU9 |
| clone | N/A |
| concentration | N/A |
| Scheda prodotto | LINK |
| format | Whole IgG |
| general_information | Angiopoietin-related protein 2, also known as angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action. |
| host | Rabbit |
| immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275-312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD), different from the related mouse sequence by one amino acid. |
| isotype | IgG |
| Secondary antibodies | LINK |
| protein_id | Q9UKU9 |
| purity | Immunogen affinity purified. |
| storage | At -20Ú C for one year. After reconstitution, at 4Ú C for one month. It can also be aliquotted and stored frozen at -20Ú C for a longer time. Avoid repeated freezing and thawing. |
| Application | WB,IHC-P |
| Target species | Hu, Ms, Rt |
| Host | Rabbit |
| Class | Polyclonal |
| Labeled | Unconjugated |
Attendere..
