| Code | A08645 |
| Brand | Boster |
| Title | Annexin VIII Polyclonal Antibody |
| Description | Annexin VIII Polyclonal Antibody |
| Size | 100 ug |
| alternative_name | Annexin-8 | AnnexinVIII | ANX8 | ANXA8 | P13928 | VAC-beta | Vascular anticoagulant-beta | Annexin VIII |
| clone | N/A |
| concentration | N/A |
| Scheda prodotto | LINK |
| format | Whole IgG |
| general_information | ANXA8 is also known as ANNEXIN VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10. |
| host | Rabbit |
| immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK), different from the related mouse and rat sequences by one amino acid. |
| isotype | IgG |
| Secondary antibodies | LINK |
| protein_id | P13928 |
| purity | Immunogen affinity purified. |
| storage | At -20Ú C for one year. After reconstitution, at 4Ú C for one month. It can also be aliquotted and stored frozen at -20Ú C for a longer time. Avoid repeated freezing and thawing. |
| Application | WB |
| Target species | Hu |
| Host | Rabbit |
| Class | Polyclonal |
| Labeled | Unconjugated |
Attendere..
