Carboxypeptidase A Picoband™ Polyclonal Antibody

Code	A05985-1
Brand	Boster
Title	Carboxypeptidase A Picoband™ Polyclonal Antibody
Description	Carboxypeptidase A Picoband™ Polyclonal Antibody
Size	100 µg
alternative_name	Carboxypeptidase A1
clone	N/A
concentration	N/A
Scheda prodotto	LINK
format	Whole IgG
general_information	Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer.
host	Rabbit
immunogen	A synthetic peptide corresponding to a sequence of human Carboxypeptidase A (KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD).
isotype	IgG
Secondary antibodies	LINK
protein_id	P15085
storage	At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Application	WB
Target species	Hu, Ms, Rt
Host	Rabbit
Class	Polyclonal
Labeled	Unconjugated