| Code | A30379 |
| Brand | Boster |
| Title | Hepatitis B Virus Picoband™ Polyclonal Antibody |
| Description | Hepatitis B Virus Picoband™ Polyclonal Antibody |
| Size | 100 ug |
| alternative_name | Large S protein |
| clone | N/A |
| concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Scheda prodotto | LINK |
| format | N/A |
| general_information | Hepatitis B virus, abbreviated HBV, is a species of the genus Orthohepadnavirus, which is likewise a part of the Hepadnaviridae family of viruses. This virus causes the disease hepatitis B. It consists of HBsAg, HBcAg (HBeAg is a splice variant), Hepatitis B virus DNA polymerase and HBx. Among these, HBsAg (also known as the Australia antigen) is the surface antigen of the hepatitis B virus (HBV). It indicates current hepatitis B infection. The viral envelope of an enveloped virus has different surface proteins from the rest of the virus which act as antigens. These antigens are recognized by antibody proteins that bind specifically to one of these surface proteins. |
| host | Rabbit |
| immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Hepatitis B Virus (4-51aa WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ). |
| isotype | N/A |
| protein_id | S |
| purity | Immunogen affinity purified. |
| storage | At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing. |
| Application | IHC-P, WB |
| Target species | Hu |
| Host | Rabbit |
| Class | Polyclonal |
| Labeled | Unconjugated |