Flat Preloader Icon Attendere..
CodeA30379
BrandBoster
TitleHepatitis B Virus Picoband™ Polyclonal Antibody
DescriptionHepatitis B Virus Picoband™ Polyclonal Antibody
Size100 ug
alternative_nameLarge S protein
cloneN/A
concentrationAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
Scheda prodottoLINK
formatN/A
general_informationHepatitis B virus, abbreviated HBV, is a species of the genus Orthohepadnavirus, which is likewise a part of the Hepadnaviridae family of viruses. This virus causes the disease hepatitis B. It consists of HBsAg, HBcAg (HBeAg is a splice variant), Hepatitis B virus DNA polymerase and HBx. Among these, HBsAg (also known as the Australia antigen) is the surface antigen of the hepatitis B virus (HBV). It indicates current hepatitis B infection. The viral envelope of an enveloped virus has different surface proteins from the rest of the virus which act as antigens. These antigens are recognized by antibody proteins that bind specifically to one of these surface proteins.
hostRabbit
immunogenA synthetic peptide corresponding to a sequence at the N-terminus of human Hepatitis B Virus (4-51aa WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ).
isotypeN/A
protein_idS
purityImmunogen affinity purified.
storageAt -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
ApplicationIHC-P, WB
Target speciesHu
HostRabbit
ClassPolyclonal
LabeledUnconjugated