| Code | A07691 |
| Brand | Boster |
| Title | HnRNP H Polyclonal Antibody |
| Description | HnRNP H Polyclonal Antibody |
| Size | 100 ug |
| alternative_name | hnRNP H | hnRNPH | Hnrnph1 | HNRPH 1 | HNRPH | HNRPH1 protein | P31943 |
| clone | N/A |
| concentration | N/A |
| Scheda prodotto | LINK |
| format | Whole IgG |
| general_information | Heterogeneous nuclear ribonucleoprotein H is a protein that in humans is encoded by the HNRNPH1 gene. This gene encodes a member of a subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA. These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some may shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNA and is very similar to the family member HNRPF. This gene may be associated with hereditary lymphedema type I. Alternatively spliced transcript variants have been described. |
| host | Rabbit |
| immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP H (23-52aa SADEVQRFFSDCKIQNGAQGIRFIYTREGR), identical to the related mouse and rat sequences. |
| isotype | IgG |
| Secondary antibodies | LINK |
| protein_id | P31943 |
| purity | Immunogen affinity purified. |
| storage | At -20Ú C for one year. After reconstitution, at 4Ú C for one month. It can also be aliquotted and stored frozen at -20Ú C for a longer time. Avoid repeated freezing and thawing. |
| Application | WB |
| Target species | Hu |
| Host | Rabbit |
| Class | Polyclonal |
| Labeled | Unconjugated |
Attendere..
