| Code | A05478 |
| Brand | Boster |
| Title | HtrA3 Polyclonal Antibody |
| Description | HtrA3 Polyclonal Antibody |
| Size | 100 ug |
| alternative_name | HTRA3 | PRSP | Tasp | P83110 |
| clone | N/A |
| concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Scheda prodotto | LINK |
| format | N/A |
| general_information | Hu HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and luteinization. The long isoform, HTRA3L, contains 453 amino acids and has a predicted molecular mass of 49 kD. It contains an N-terminal signal peptide, followed by an insulin/IGF (see 147440)-binding domain, a Kazal-type S protease inhibitor domain, a trypsin protease domain, and a PDZ domain. The short isoform, HTRA3S, contains 357 amino acids and has a predicted molecular mass of 38 kD. |
| host | Rabbit |
| immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human HtrA3 (330-362aa FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids. |
| isotype | N/A |
| protein_id | HTRA3 |
| purity | Immunogen affinity purified. |
| storage | At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing. |
| Application | WB |
| Target species | Hu |
| Host | Rabbit |
| Class | Polyclonal |
| Labeled | Unconjugated |
Attendere..
