LMO1 Polyclonal Antibody

Code	A06093-1
Brand	Boster
Title	LMO1 Polyclonal Antibody
Description	LMO1 Polyclonal Antibody
Size	100 ug
alternative_name	LMO1 \| LMO-1 \| LMO 1 \| RBTN 1 \| RBTN1 \| RHOM 1 \| RHOM1 \| Rhombotin1 \| Rhombotin-1 \| Rhombotin 1 \| TTG 1 \| TTG1 \| P25800
clone	N/A
concentration	N/A
Scheda prodotto	LINK
format	Whole IgG
general_information	Rhombotin-1 is a protein that in humans is encoded by the LMO1 gene. This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions
host	Rabbit
immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human LMO1 (127-156aa DKFFLKNNMILCQMDYEEGQLNGTFESQVQ), different from the related mouse sequence by two amino acids.
isotype	IgG
Secondary antibodies	LINK
protein_id	P25800
purity	Immunogen affinity purified.
storage	At -20Ú C for one year. After reconstitution, at 4Ú C for one month. It can also be aliquotted and stored frozen at -20Ú C for a longer time. Avoid repeated freezing and thawing.
Application	WB
Target species	Hu, Ms, Rt
Host	Rabbit
Class	Polyclonal
Labeled	Unconjugated