| Code | A05725-1 |
| Brand | Boster |
| Title | P2RY5 Picoband™ Polyclonal Antibody |
| Description | P2RY5 Picoband™ Polyclonal Antibody |
| Size | 100 µg |
| alternative_name | Lysophosphatidic acid receptor 6 |
| clone | N/A |
| concentration | N/A |
| Scheda prodotto | LINK |
| format | Whole IgG |
| general_information | Lysophosphatidic acid receptor 6 also known as LPA6, P2RY5, and GPR87, is a protein that in humans is encoded by the LPAR6 gene. The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants. |
| host | Rabbit |
| immunogen | A synthetic peptide corresponding to a sequence of human P2RY5 (DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK). |
| isotype | IgG |
| Secondary antibodies | LINK |
| protein_id | A05725-1 |
| storage | At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing. |
| Application | WB |
| Target species | Hu, Ms, Rt |
| Host | Rabbit |
| Class | Polyclonal |
| Labeled | Unconjugated |
Attendere..
