| Code | A06439-1 |
| Brand | Boster |
| Title | RECK Picoband™ Polyclonal Antibody |
| Description | RECK Picoband™ Polyclonal Antibody |
| Size | 100 µg |
| alternative_name | Reversion-inducing cysteine-rich protein with Kazal motifs |
| clone | N/A |
| concentration | N/A |
| Scheda prodotto | LINK |
| format | Whole IgG |
| general_information | Reversion-inducing-cysteine-rich protein with kazal motifs, also known as RECK, is a human gene, thought to be a metastasis suppressor. The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis. Several transcript variants encoding different isoforms have been found for this gene. |
| host | Rabbit |
| immunogen | A synthetic peptide corresponding to a sequence of human RECK (NAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIA). |
| isotype | IgG |
| Secondary antibodies | LINK |
| protein_id | O95980 |
| storage | At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing. |
| Application | WB |
| Target species | Hu, Ms |
| Host | Rabbit |
| Class | Polyclonal |
| Labeled | Unconjugated |
Attendere..
