ST7 Polyclonal Antibody

Code	A07235
Brand	Boster
Title	ST7 Polyclonal Antibody
Description	ST7 Polyclonal Antibody
Size	100 ug
alternative_name	ETS7q \| FAM4A \| FAM4A1 \| HELG \| RAY1 \| SEN4 \| ST7 \| TSG7 \| Q9NRC1
clone	N/A
concentration	N/A
Scheda prodotto	LINK
format	Whole IgG
general_information	Suppressor of tumorigenicity protein 7 is a protein that in humans is encoded by the ST7 gene. The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.
host	Rabbit
immunogen	A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRL), identical to the related mouse and rat sequences.
isotype	IgG
Secondary antibodies	LINK
protein_id	Q9NRC1
purity	Immunogen affinity purified.
storage	At -20Ú C for one year. After reconstitution, at 4Ú C for one month. It can also be aliquotted and stored frozen at -20Ú C for a longer time. Avoid repeated freezing and thawing.
Application	WB
Target species	Hu
Host	Rabbit
Class	Polyclonal
Labeled	Unconjugated